TFF3 Rabbit mAb (A4592)
$148.00 – $548.00
Abclonal TFF3 Rabbit mAb (Catalog Number: A4592) Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides.
- Details & Specifications
- References
- More Offers
| Catalog No. | A4592 |
|---|---|
| Product Name | TFF3 Rabbit mAb (A4592) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ITF; P1B; TFI |
| Gene Name | TFF3 |
| Protein Name | TFF3 |
| Uniprot/Swissprot ID | Q07654 |
| Gene ID | 7033 |
| Clone | ARC2664 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A4592: TFF3 Rabbit mAb
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Immunogen Information about TFF3 Rabbit mAb (A4592)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-80 of human TFF3 (Q07654).
Sequence：MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Gene ID：7033
Swiss prot：Q07654
Synonyms：ITF; P1B; TFI; TFF3
Calculated MW：9kDa
Observed MW：
Images of TFF3 Rabbit mAb (A4592)
Immunohistochemistry analysis of TFF3 in paraffin-embedded human appendix using TFF3 Rabbit mAb (A4592) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of TFF3 in paraffin-embedded human colon carcinoma using TFF3 Rabbit mAb (A4592) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of TFF3 in paraffin-embedded human colon using TFF3 Rabbit mAb (A4592) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: TFF3 Rabbit mAb (Catalog Number: A4592) Abclonal
