ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD48 mAb (Catalog Number: A21946) encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins.
- Details & Specifications
- References
| Catalog No. | A21946 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD48 mAb (A21946) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102 |
| Gene Name | CD48 |
| Protein Name | CD48 |
| Uniprot/Swissprot ID | P09326 |
| Gene ID | 962 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21946: ABflo® 647 Rabbit anti-Human CD48 mAb
This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48(NP_001769.2)
Sequence:QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Gene ID:962
Swiss prot:P09326
Synonyms:BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
Calculated MW:28kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD48 mAb(A21946, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD48 mAb(A21946, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD48 mAb (Catalog Number: A21946) Abclonal


