ABflo® 488 Rabbit anti-Human CD55 mAb (A21942)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD55 mAb (Catalog Number: A21942) encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells.
- Details & Specifications
- References
| Catalog No. | A21942 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD55 mAb (A21942) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CR; TC; DAF; CROM; CHAPLE |
| Gene Name | CD55 |
| Protein Name | CD55 |
| Uniprot/Swissprot ID | P08174 |
| Gene ID | 1604 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21942: ABflo® 488 Rabbit anti-Human CD55 mAb
This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD55 mAb (A21942)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 35-353 of human CD55 (NP_000565.1).
Sequence:DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS
Gene ID:1604
Swiss prot:P08174
Synonyms:CR; TC; DAF; CROM; CHAPLE
Calculated MW:41kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human CD55 mAb (A21942)

Flow cytometry:1X10^6 SH-SY5Y cells (negative control, left) and K-562 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD55 mAb(A21942, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 SH-SY5Y cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD55 mAb(A21942, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD55 mAb (Catalog Number: A21942) Abclonal


