IGF1 Rabbit mAb (A0830)

IGF1 Rabbit mAb (A0830)

IGF1 Rabbit mAb (A0830)

$148.00$548.00

In stock

$148.00$548.00

Abclonal IGF1 Rabbit mAb (Catalog Number: A0830) encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development.

Store
SKU: A0830 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A0830
Product NameIGF1 Rabbit mAb (A0830)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms IGF; MGF; IGFI; IGF-I
Gene Name IGF1
Protein Name IGF1
Uniprot/Swissprot ID P05019
Gene ID 3479
Clone ARC0505
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A0830: IGF1 Rabbit mAb

The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.

Immunogen Information about IGF1 Rabbit mAb (A0830)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 70-150 of human IGF1 (P05019).
Sequence:GFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
Gene ID:3479
Swiss prot:P05019
Synonyms:IGF; MGF; IGFI; IGF-I; IGF1
Calculated MW:22kDa
Observed MW:Refer to figures

Images of IGF1 Rabbit mAb (A0830)

Immunohistochemistry analysis of IGF1 in paraffin-embedded human colon using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of IGF1 in paraffin-embedded human liver using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of IGF1 in paraffin-embedded Human lung adenocarcinoma using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of IGF1 in paraffin-embedded human placenta using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: IGF1 Rabbit mAb (Catalog Number: A0830) Abclonal

No more offers for this product!