IGF1 Rabbit mAb (A0830)
$148.00 – $548.00
Abclonal IGF1 Rabbit mAb (Catalog Number: A0830) encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development.
- Details & Specifications
- References
- More Offers
Catalog No. | A0830 |
---|---|
Product Name | IGF1 Rabbit mAb (A0830) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | IGF; MGF; IGFI; IGF-I |
Gene Name | IGF1 |
Protein Name | IGF1 |
Uniprot/Swissprot ID | P05019 |
Gene ID | 3479 |
Clone | ARC0505 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human, Mouse |
Conjugate | Unconjugated |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A0830: IGF1 Rabbit mAb
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
Immunogen Information about IGF1 Rabbit mAb (A0830)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 70-150 of human IGF1 (P05019).
Sequence:GFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
Gene ID:3479
Swiss prot:P05019
Synonyms:IGF; MGF; IGFI; IGF-I; IGF1
Calculated MW:22kDa
Observed MW:Refer to figures
Images of IGF1 Rabbit mAb (A0830)
Immunohistochemistry analysis of IGF1 in paraffin-embedded human colon using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IGF1 in paraffin-embedded human liver using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IGF1 in paraffin-embedded Human lung adenocarcinoma using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IGF1 in paraffin-embedded human placenta using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: IGF1 Rabbit mAb (Catalog Number: A0830) Abclonal