von Willebrand factor (VWF) Rabbit mAb (A21054)

von Willebrand factor (VWF) Rabbit mAb (A21054)

von Willebrand factor (VWF) Rabbit mAb (A21054)

$148.00$548.00

In stock

$148.00$548.00

Abclonal von Willebrand factor (VWF) Rabbit mAb (Catalog Number: A21054) encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes.

Store
SKU: A21054 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21054
Product Namevon Willebrand factor (VWF) Rabbit mAb (A21054)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms VWD; F8VWF
Gene Name VWF
Protein Name VWF
Uniprot/Swissprot ID P04275
Gene ID 7450
Clone ARC52173
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21054: von Willebrand factor (VWF) Rabbit mAb

This gene encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes. These complexes function in the adhesion of platelets to sites of vascular injury and the transport of various proteins in the blood. Mutations in this gene result in von Willebrand disease, an inherited bleeding disorder. An unprocessed pseudogene has been found on chromosome 22.

Immunogen Information about von Willebrand factor (VWF) Rabbit mAb (A21054)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 2645-2813 of human von Willebrand factor (VWF) (NP_000543.3).
Sequence:LPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Gene ID:7450
Swiss prot:P04275
Synonyms:VWD; F8VWF; von Willebrand factor (VWF)
Calculated MW:309kDa
Observed MW:Refer to figures

Images of von Willebrand factor (VWF) Rabbit mAb (A21054)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: von Willebrand factor (VWF) Rabbit mAb (Catalog Number: A21054) Abclonal

No more offers for this product!