von Willebrand factor (VWF) Rabbit mAb (A21054)
$148.00 – $548.00
Abclonal von Willebrand factor (VWF) Rabbit mAb (Catalog Number: A21054) encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes.
- Details & Specifications
- References
- More Offers
Catalog No. | A21054 |
---|---|
Product Name | von Willebrand factor (VWF) Rabbit mAb (A21054) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | VWD; F8VWF |
Gene Name | VWF |
Protein Name | VWF |
Uniprot/Swissprot ID | P04275 |
Gene ID | 7450 |
Clone | ARC52173 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human, Mouse |
Conjugate | Unconjugated |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21054: von Willebrand factor (VWF) Rabbit mAb
This gene encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes. These complexes function in the adhesion of platelets to sites of vascular injury and the transport of various proteins in the blood. Mutations in this gene result in von Willebrand disease, an inherited bleeding disorder. An unprocessed pseudogene has been found on chromosome 22.
Immunogen Information about von Willebrand factor (VWF) Rabbit mAb (A21054)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 2645-2813 of human von Willebrand factor (VWF) (NP_000543.3).
Sequence:LPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Gene ID:7450
Swiss prot:P04275
Synonyms:VWD; F8VWF; von Willebrand factor (VWF)
Calculated MW:309kDa
Observed MW:Refer to figures
Images of von Willebrand factor (VWF) Rabbit mAb (A21054)
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using von Willebrand factor (VWF) Rabbit mAb (A21054) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: von Willebrand factor (VWF) Rabbit mAb (Catalog Number: A21054) Abclonal