PAX8 Rabbit mAb (A22164)

PAX8 Rabbit mAb (A22164)

PAX8 Rabbit mAb (A22164)

$148.00$548.00

In stock

$148.00$548.00

Abclonal PAX8 Rabbit mAb (Catalog Number: A22164) encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain.

Store
SKU: A22164 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22164
Product NamePAX8 Rabbit mAb (A22164)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms PAX-8
Gene Name PAX8
Protein Name PAX8
Uniprot/Swissprot ID Q06710
Gene ID 7849
Clone ARC55538
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22164: PAX8 Rabbit mAb

This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen Information about PAX8 Rabbit mAb (A22164)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1).
Sequence:DSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
Gene ID:7849
Swiss prot:Q06710
Synonyms:PAX-8; PAX8
Calculated MW:48kDa
Observed MW:Refer to figures

Images of PAX8 Rabbit mAb (A22164)

Immunohistochemistry analysis of PAX8 in paraffin-embedded human thyroid cancer using PAX8 Rabbit mAb (A22164) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: PAX8 Rabbit mAb (Catalog Number: A22164) Abclonal

No more offers for this product!