ABflo® 488 Rabbit anti-Human CD86 mAb (A21940)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD86 mAb (Catalog Number: A21940) encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A21940 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD86 mAb (A21940) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | B70; B7-2; B7.2; LAB72; CD28LG2 |
| Gene Name | CD86 |
| Protein Name | CD86 |
| Uniprot/Swissprot ID | P42081 |
| Entrez GeneID | 942 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21940: ABflo® 488 Rabbit anti-Human CD86 mAb
This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD86 mAb (A21940)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 20-241 of human CD86 (NP_787058.5).
Sequence：LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQP
Gene ID：942
Swiss prot：P42081
Synonyms：B70; B7-2; B7.2; LAB72; CD28LG2
Calculated MW：38kDa
Observed MW：Refer to figures
Images of ABflo® 488 Rabbit anti-Human CD86 mAb (A21940)
Flow cytometry:1X10^6 K-562 cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD86 mAb(A21940, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or ABflo® 488 Rabbit anti-Human CD86 mAb (A21940, 2 μg/mL, right). Cells in the monocyte gate were used for analysis.
Please remember our product information: ABflo® 488 Rabbit anti-Human CD86 mAb (Catalog Number: A21940) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |