ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD40 mAb (Catalog Number: A21947) is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A21947 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD40 mAb (A21947) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | p50; Bp50; CDW40; TNFRSF5 |
| Gene Name | CD40 |
| Protein Name | CD40 |
| Uniprot/Swissprot ID | P25942 |
| Entrez GeneID | 958 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21947: ABflo® 647 Rabbit anti-Human CD40 mAb
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (P25942).
Sequence：EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Gene ID：958
Swiss prot：P25942
Synonyms：p50; Bp50; CDW40; TNFRSF5
Calculated MW：31kDa
Observed MW：Refer to figures
Images of ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD40 mAb(A21947, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD40 mAb (Catalog Number: A21947) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |