CD79a Rabbit mAb (A19024)
$148.00 – $548.00
Abclonal CD79a Rabbit mAb (Catalog Number: A19024) The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig).
- Details & Specifications
- References
- More Offers
| Catalog No. | A19024 |
|---|---|
| Product Name | CD79a Rabbit mAb (A19024) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | IGA; MB1; MB-1; IGAlpha |
| Gene Name | CD79A |
| Protein Name | CD79A |
| Uniprot/Swissprot ID | P11912 |
| Gene ID | 973 |
| Clone | ARC0482 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19024: CD79a Rabbit mAb
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Immunogen Information about CD79a Rabbit mAb (A19024)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD79a (P11912).
Sequence：MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSH
Gene ID：973
Swiss prot：P11912
Synonyms：IGA; MB1; MB-1; IGAlpha; CD79a
Calculated MW：25kDa
Observed MW：45kDa
Images of CD79a Rabbit mAb (A19024)
Western blot analysis of extracts of Raji cells, using CD79a antibody (A19024) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human appendix using CD79a Rabbit mAb (A19024) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human mantle cell lymphoma using CD79a Rabbit mAb (A19024) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using CD79a Rabbit mAb (A19024) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: CD79a Rabbit mAb (Catalog Number: A19024) Abclonal
