SATB2 Rabbit mAb (A19837)

SATB2 Rabbit mAb (A19837)

SATB2 Rabbit mAb (A19837)

$148.00$548.00

In stock

$148.00$548.00

Abclonal SATB2 Rabbit mAb (Catalog Number: A19837) encodes a DNA binding protein that specifically binds nuclear matrix attachment regions.

Store
SKU: A19837 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19837
Product NameSATB2 Rabbit mAb (A19837)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms GLSS; DEL2Q32Q33; C2DELq32q33
Gene Name SATB2
Protein Name SATB2
Uniprot/Swissprot ID Q3ZB87
Gene ID 23314
Clone ARC2363
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19837: SATB2 Rabbit mAb

This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen Information about SATB2 Rabbit mAb (A19837)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SATB2 (Q9UPW6).
Sequence:SMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP
Gene ID:23314
Swiss prot:Q3ZB87
Synonyms:GLSS; DEL2Q32Q33; C2DELq32q33; SATB2
Calculated MW:83kDa
Observed MW:100kDa

Images of SATB2 Rabbit mAb (A19837)

Western blot analysis of lysates from Rat brain, using SATB2 Rabbit mAb (A19837) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of SATB2 in paraffin-embedded human appendix using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SATB2 in paraffin-embedded human colon carcinoma using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SATB2 in paraffin-embedded human colon using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg SATB2 antibody (A19837). Western blot was performed from the immunoprecipitate using SATB2 antibody (A19837) at a dilution of 1:1000.

Please remember our product information: SATB2 Rabbit mAb (Catalog Number: A19837) Abclonal

No more offers for this product!