CD34 Rabbit mAb (A22197)
$148.00 – $548.00
Abclonal CD34 Rabbit mAb (Catalog Number: A22197) encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells.
- Details & Specifications
- References
| Catalog No. | A22197 |
|---|---|
| Product Name | CD34 Rabbit mAb (A22197) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD34;CD34 molecule;GIG3;MORT1 |
| Gene Name | CD34 |
| Protein Name | CD34 |
| Uniprot/Swissprot ID | P28906 |
| Gene ID | 947 |
| Clone | ARC55664 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22197: CD34 Rabbit mAb
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about CD34 Rabbit mAb (A22197)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 32-290 of human CD34 (NP_001020280.1).
Sequence:SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Gene ID:947
Swiss prot:P28906
Synonyms:CD34; CD34 molecule; GIG3; MORT1
Calculated MW:41kDa
Observed MW:90-120kDa
Images of CD34 Rabbit mAb (A22197)

Western blot analysis of various lysates, using CD34 antibody (A22197) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:200000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded human kidney using CD34 Rabbit mAb (A22197) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using CD34 Rabbit mAb (A22197) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD34 Rabbit mAb (A22197) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: CD34 Rabbit mAb (Catalog Number: A22197) Abclonal







