ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23174)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb (Catalog Number: A23174) encodes a C-type lectin that functions in cell adhesion and pathogen recognition.
- Details & Specifications
- References
- More Offers
Catalog No. | A23174 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23174) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR |
Gene Name | CLEC4M |
Protein Name | CLEC4M |
Uniprot/Swissprot ID | Q9H2X3 |
Gene ID | 10332 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23174: ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb
This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses including Ebola, hepatitis C, HIV-1, influenza A, West Nile virus and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain of variable length, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CD209 (Gene ID: 30835), also known as DC-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression in endothelial cells of the liver, lymph node and placenta. Polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection.
Immunogen Information about ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23174)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 71-399 of human DC-SIGNR/CD299 (NP_055072.3).
Sequence: QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Gene ID:10332
Swiss prot:Q9H2X3
Synonyms:CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
Calculated MW:24kDa-45kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23174)
Flow cytometry:1X10^6 293T cells (negative control, Left) and 293T(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb(A23174, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293T(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb(A23174, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb(A23174, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb(A23174, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human DC-SIGNR/CD299 mAb (Catalog Number: A23174) Abclonal