ABflo® 488 Rabbit anti-Human CD93 mAb (A23012)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD93 mAb (Catalog Number: A23012) encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A23012 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Human CD93 mAb (A23012) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | C1QR1; C1qRP; CDw93; ECSM3; MXRA4; C1qR(P); dJ737E23.1 |
Gene Name | CD93 |
Protein Name | CD93 |
Uniprot/Swissprot ID | Q9NPY3 |
Entrez GeneID | 22918 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Human |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23012: ABflo® 488 Rabbit anti-Human CD93 mAb
The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD93 mAb (A23012)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 24-580 of human CD93 (NP_036204.2).
Sequence:ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
Gene ID:22918
Swiss prot:Q9NPY3
Synonyms:C1QR1; C1qRP; CDw93; ECSM3; MXRA4; C1qR(P); dJ737E23.1
Calculated MW:69kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human CD93 mAb (A23012)
Flow cytometry:1X10^6 Jurkat cells (negative control, Left) and U-937 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD93 mAb(A23012, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 U-937 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD93 mAb(A23012, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD93 mAb(A23012, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD93 mAb(A23012, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD93 mAb (Catalog Number: A23012) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |