Tyrosinase Rabbit mAb (A21267)
$148.00 – $548.00
Abclonal Tyrosinase Rabbit mAb (Catalog Number: A21267) encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin.
- Details & Specifications
- References
- More Offers
| Catalog No. | A21267 |
|---|---|
| Product Name | Tyrosinase Rabbit mAb (A21267) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3 |
| Gene Name | TYR |
| Protein Name | TYR |
| Uniprot/Swissprot ID | P14679 |
| Gene ID | 7299 |
| Clone | ARC53166 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21267: Tyrosinase Rabbit mAb
The enzyme encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin. The enzyme has both tyrosine hydroxylase and dopa oxidase catalytic activities, and requires copper for function. Mutations in this gene result in oculocutaneous albinism, and nonpathologic polymorphisms result in skin pigmentation variation. The human genome contains a pseudogene similar to the 3′ half of this gene.
Immunogen Information about Tyrosinase Rabbit mAb (A21267)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1).
Sequence：FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
Gene ID：7299
Swiss prot：P14679
Synonyms：ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3; Tyrosinase
Calculated MW：60kDa
Observed MW：Refer to figures
Images of Tyrosinase Rabbit mAb (A21267)
Immunohistochemistry analysis of Tyrosinase in paraffin-embedded Human malignant melanoma using Tyrosinase Rabbit mAb (A21267) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of paraffin-embedded Human malignant melanoma tissue using Tyrosinase Rabbit mAb (A21267, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Please remember our product information: Tyrosinase Rabbit mAb (Catalog Number: A21267) Abclonal
