Tyrosinase Rabbit mAb (A21267)

Tyrosinase Rabbit mAb (A21267)

Tyrosinase Rabbit mAb (A21267)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Tyrosinase Rabbit mAb (Catalog Number: A21267) encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin.

Store
SKU: A21267 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21267
Product NameTyrosinase Rabbit mAb (A21267)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3
Gene Name TYR
Protein Name TYR
Uniprot/Swissprot ID P14679
Gene ID 7299
Clone ARC53166
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21267: Tyrosinase Rabbit mAb

The enzyme encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin. The enzyme has both tyrosine hydroxylase and dopa oxidase catalytic activities, and requires copper for function. Mutations in this gene result in oculocutaneous albinism, and nonpathologic polymorphisms result in skin pigmentation variation. The human genome contains a pseudogene similar to the 3′ half of this gene.

Immunogen Information about Tyrosinase Rabbit mAb (A21267)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1).
Sequence:FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
Gene ID:7299
Swiss prot:P14679
Synonyms:ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3; Tyrosinase
Calculated MW:60kDa
Observed MW:Refer to figures

Images of Tyrosinase Rabbit mAb (A21267)

Immunohistochemistry analysis of Tyrosinase in paraffin-embedded Human malignant melanoma using Tyrosinase Rabbit mAb (A21267) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of paraffin-embedded Human malignant melanoma tissue using Tyrosinase Rabbit mAb (A21267, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Please remember our product information: Tyrosinase Rabbit mAb (Catalog Number: A21267) Abclonal