[KO Validated] Vimentin Rabbit mAb (A19607)

[KO Validated] Vimentin Rabbit mAb (A19607)

[KO Validated] Vimentin Rabbit mAb (A19607)

$148.00$548.00

In stock

$148.00$548.00

Abclonal [KO Validated] Vimentin Rabbit mAb (Catalog Number: A19607) encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton.

Store
SKU: A19607 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19607
Product Name[KO Validated] Vimentin Rabbit mAb (A19607)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CTRCT30;HEL113;Vimentin;VIM;vimentin
Gene Name VIM
Protein Name VIM
Uniprot/Swissprot ID P08670
Gene ID 7431
Clone ARC0086
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19607: [KO Validated] Vimentin Rabbit mAb

This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients.

Immunogen Information about [KO Validated] Vimentin Rabbit mAb (A19607)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670).
Sequence: DEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
Gene ID:7431
Swiss prot:P08670
Synonyms:CTRCT30; HEL113; Vimentin; VIM; vimentin; in
Calculated MW: 54kDa
Observed MW: 54kDa

Images of [KO Validated] Vimentin Rabbit mAb (A19607)


Western blot analysis of various lysates using [KO Validated] Vimentin Rabbit mAb (A19607) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from wild type (WT) and Vimentin knockout (KO) 293T cells, using [KO Validated] Vimentin Rabbit mAb (A19607) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of Vimentin in paraffin-embedded human colon using [KO Validated] Vimentin Rabbit mAb (A19607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of Vimentin in paraffin-embedded human liver cancer using [KO Validated] Vimentin Rabbit mAb (A19607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of Vimentin in paraffin-embedded human lung cancer using [KO Validated] Vimentin Rabbit mAb (A19607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Confocal Immunofluorescence analysis of U2OS cells using KRR1 Rabbit pAb (A4487) at dilution of 1:100 (40x lens)(red). Vimentin (A19607: Vimentin Rabbit mAb) for Cytoskeleton staining(green), DAPI for nuclear staining(blue).

Confocal imaging of HeLa cells using [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). The cells were counterstained with Aurora B Rabbit mAb (A19539, dilution 1:800) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Confocal imaging of HeLa cells using [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). The cells were counterstained with Aurora B Rabbit mAb (A19539, dilution 1:800) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Please remember our product information: [KO Validated] Vimentin Rabbit mAb (Catalog Number: A19607) Abclonal