[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

$148.00$548.00

In stock

$148.00$548.00

Abclonal [KO Validated] SMARCB1/SNF5 Rabbit mAb (Catalog Number: A3247) encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively.

Store
SKU: A3247 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A3247
Product Name[KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144
Gene Name SMARCB1
Protein Name SMARCB1
Uniprot/Swissprot ID Q12824
Gene ID 6598
Clone ARC53139
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A3247: [KO Validated] SMARCB1/SNF5 Rabbit mAb

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.

Immunogen Information about [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).
Sequence:LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
Gene ID:6598
Swiss prot:Q12824
Synonyms:RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; F5
Calculated MW:44kDa
Observed MW:44kDa

Images of [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247)

Western blot analysis of various lysates, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:2000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type(WT) and SMARCB1/SNF5 Rabbit mAb knockout (KO) HeLa(KO) cells, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Human epithelioid sarcoma (ini-1 deletion) using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Human colon carcinoma using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Rat lung using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Mouse heart using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of SMARCB1/SNF5 in paraffin-embedded Human undifferentiated carcinoma of esophagus using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: [KO Validated] SMARCB1/SNF5 Rabbit mAb (Catalog Number: A3247) Abclonal

No more offers for this product!