[KO Validated] β-Catenin Rabbit mAb (A19657)
$148.00 – $548.00
Abclonal [KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657) encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs).
- Details & Specifications
- References
- More Offers
| Catalog No. | A19657 |
|---|---|
| Product Name | [KO Validated] β-Catenin Rabbit mAb (A19657) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | EVR7; CTNNB; MRD19; NEDSDV; armadillo |
| Gene Name | CTNNB1 |
| Protein Name | CTNNB1 |
| Uniprot/Swissprot ID | P35222 |
| Gene ID | 1499 |
| Clone | ARC0136 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19657: [KO Validated] β-Catenin Rabbit mAb
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.
Immunogen Information about [KO Validated] β-Catenin Rabbit mAb (A19657)
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (P35222).
Sequence: MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Gene ID: 1499
Swiss prot: P35222
Synonyms: EVR7; CTNNB; MRD19; NEDSDV; armadillo; in
Calculated MW: 85kDa
Observed MW: 92kDa
Images of [KO Validated] β-Catenin Rabbit mAb (A19657)
![[KO Validated] β-Catenin Rabbit mAb (A19657)](https://www.ushelf.com/wp-content/themes/porto/images/lazy.png)
Western blot analysis of lysates from HeLa cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
![A19657: [KO Validated] β-Catenin Rabbit mAb](https://www.ushelf.com/wp-content/themes/porto/images/lazy.png)
Western blot analysis of lysates from Mouse brain, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
![[KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657)](https://www.ushelf.com/wp-content/themes/porto/images/lazy.png)
Western blot analysis of lysates from wild type (WT) and β-Catenin knockout (KO) 293T cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
![Abclonal [KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657)](https://www.ushelf.com/wp-content/themes/porto/images/lazy.png)
Western blot analysis of lysates from NIH/3T3 cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type(WT) and [KO Validated] β-Catenin knockout (KO) 293T(KO) cells, using [KO Validated] β-Catenin Rabbit mAb (A19657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human kidney using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human liver cancer using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human liver using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of β-Catenin in paraffin-embedded human thyroid cancer using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of C6 cells using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg β-Catenin antibody (A19657). Western blot was performed from the immunoprecipitate using β-Catenin (A19657) at a dilution of 1:1000.
Please remember our product information: [KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657) Abclonal
![A19657: [KO Validated] β-Catenin Rabbit mAb](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-2.jpg)
![[KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657)](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-3.jpg)
![Abclonal [KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657)](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-4.jpg)
![[KO Validated] β-Catenin Rabbit mAb (A19657)](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-1-150x150.jpg)
![A19657: [KO Validated] β-Catenin Rabbit mAb](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-2-150x150.jpg)
![[KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657)](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-3-150x150.jpg)
![Abclonal [KO Validated] β-Catenin Rabbit mAb (Catalog Number: A19657)](https://www.ushelf.com/wp-content/uploads/2023/10/A19657-4-150x150.jpg)
