CD74 Rabbit mAb (A9149)
$148.00 – $548.00
Abclonal CD74 Rabbit mAb (Catalog Number: A9149) encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response.
- Details & Specifications
- References
- More Offers
| Catalog No. | A9149 |
|---|---|
| Product Name | CD74 Rabbit mAb (A9149) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | II; p33; CLIP; DHLAG; HLADG; Ia-GAMMA |
| Gene Name | CD74 |
| Protein Name | CD74 |
| Uniprot/Swissprot ID | P04233 |
| Gene ID | 972 |
| Clone | ARC1452 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A9149: CD74 Rabbit mAb
The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Immunogen Information about CD74 Rabbit mAb (A9149)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD74 (P04233).
Sequence：MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKP
Gene ID：972
Swiss prot：P04233
Synonyms：II; p33; CLIP; DHLAG; HLADG; Ia-GAMMA; CD74
Calculated MW：34kDa
Observed MW：30-40kDa
Images of CD74 Rabbit mAb (A9149)
Western blot analysis of extracts of various cell lines, using CD74 Rabbit mAb (A9149) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD74 Rabbit mAb (A9149) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human small cell lung cancer using CD74 Rabbit mAb (A9149) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using CD74 Rabbit mAb (A9149) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: CD74 Rabbit mAb (Catalog Number: A9149) Abclonal
