CD63 Rabbit mAb (A19023)
$148.00 – $548.00
Abclonal CD63 Rabbit mAb (Catalog Number: A19023) encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A19023 |
|---|---|
| Product Name | CD63 Rabbit mAb (A19023) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | MLA1; ME491; LAMP-3; OMA81H; TSPAN30 |
| Gene Name | CD63 |
| Protein Name | CD63 |
| Uniprot/Swissprot ID | P08962 |
| Entrez GeneID | 967 |
| Clone | ARC51703 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | WB, IHC-P |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19023: CD63 Rabbit mAb
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
Immunogen Information about CD63 Rabbit mAb (A19023)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1).
Sequence：AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Gene ID：967
Swiss prot：P08962
Synonyms：MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63
Calculated MW：17kDa/23kDa/25kDa
Observed MW：30-65kDa
Images of CD63 Rabbit mAb (A19023)
Western blot analysis of lysates from A375 cells, using CD63 Rabbit mAb (A19023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of various lysates, using CD63 Rabbit mAb (A19023) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of CD63 in paraffin-embedded human colon using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CD63 in paraffin-embedded human tonsil using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: CD63 Rabbit mAb (Catalog Number: A19023) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |