ABflo® 488 Rabbit anti-Human TROP-2 mAb (A22577)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human TROP-2 mAb (Catalog Number: A22577) This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals.
- Details & Specifications
- References
| Catalog No. | A22577 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human TROP-2 mAb (A22577) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
| Gene Name | TACSTD2 |
| Protein Name | TACSTD2 |
| Uniprot/Swissprot ID | P09758 |
| Gene ID | 4070 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22577: ABflo® 488 Rabbit anti-Human TROP-2 mAb
This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
Immunogen Information about ABflo® 488 Rabbit anti-Human TROP-2 mAb (A22577)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID:4070
Swiss prot:P09758
Synonyms:EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Calculated MW:36kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human TROP-2 mAb (A22577)

Immunofluorescence analysis of MCF7 using ABflo® 488 Rabbit anti-Human TROP-2 mAb (A22577) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Flow cytometry:1X10^6 U-118MG cells (negative control, left) and MCF7 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human TROP-2 mAb(A22577, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 488 Rabbit anti-Human TROP-2 mAb (Catalog Number: A22577) Abclonal


