ABflo® 488 Rabbit anti-Human CD97 mAb (A22500)

ABflo® 488 Rabbit anti-Human CD97 mAb (A22500)

ABflo® 488 Rabbit anti-Human CD97 mAb (A22500)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD97 mAb (Catalog Number: A22500) encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions.

Store
SKU: A22500 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22500
Product NameABflo® 488 Rabbit anti-Human CD97 mAb (A22500)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD97; TM7LN1
Gene Name ADGRE5
Protein Name ADGRE5
Uniprot/Swissprot ID P48960
Gene ID 976
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22500: ABflo® 488 Rabbit anti-Human CD97 mAb

This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD97 mAb (A22500)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 21-398 of human CD97 (NP_510966.1).
Sequence:QDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAV
Gene ID:976
Swiss prot:P48960
Synonyms:CD97; TM7LN1
Calculated MW:81kDa/86kDa/92kDa
Observed MW:Refer to figures

Images of ABflo® 488 Rabbit anti-Human CD97 mAb (A22500)

Flow cytometry: 1X10^6 MOLT-4 cells (Low Expression, left) and U-937 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD97 mAb (A22500, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 U-937 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD97 mAb (A22500, 5 μl/Test, right).

Flow cytometry: 1X10^6 MOLT-4 cells (Low Expression) were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD97 mAb (A22500, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD97 mAb (A22500, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD97 mAb (A22500, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD97 mAb (Catalog Number: A22500) Abclonal