ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)

ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)

ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)

$140.00$388.00

In stock

$140.00$388.00

Abclonal ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (Catalog Number: A23014) Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups.

Store
SKU: A23014 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23014
Product NameABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C)
Gene Name GYPA
Protein Name GYPA
Uniprot/Swissprot ID P02724
Gene ID 2993
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23014: ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb

Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-91 of human CD235a (NP_002090.4).
Sequence:SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Gene ID:2993
Swiss prot:P02724
Synonyms:MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C)
Calculated MW:13kDa/16kDa
Observed MW:Refer to figures

Images of ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)

Flow cytometry:1X10^6 THP1 cells (negative control, Left) and HEL cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb(A23014, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb(A23014, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (Catalog Number: A23014) Abclonal