SMMHC/MYH11 Rabbit mAb (A4064)
$148.00 – $548.00
Abclonal SMMHC/MYH11 Rabbit mAb (Catalog Number: A4064) encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits.
- Details & Specifications
- References
- More Offers
| Catalog No. | A4064 |
|---|---|
| Product Name | SMMHC/MYH11 Rabbit mAb (A4064) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | AAT4; FAA4; SMHC; SMMHC; VSCM2; SMMS-1 |
| Gene Name | MYH11 |
| Protein Name | MYH11 |
| Uniprot/Swissprot ID | P35749 |
| Gene ID | 4629 |
| Clone | ARC51911 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A4064: SMMHC/MYH11 Rabbit mAb
The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4.
Immunogen Information about SMMHC/MYH11 Rabbit mAb (A4064)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1).
Sequence：DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL
Gene ID：4629
Swiss prot：P35749
Synonyms：AAT4; FAA4; SMHC; SMMHC; VSCM2; SMMS-1; SMMHC/MYH11
Calculated MW：227kDa
Observed MW：250kDa
Images of SMMHC/MYH11 Rabbit mAb (A4064)
Western blot analysis of lysates from Mouse lung, using SMMHC/SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of lysates from Rat lung, using SMMHC/SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of SMMHC/MYH11 in paraffin-embedded human colon carcinoma using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of SMMHC/MYH11 in paraffin-embedded human colon using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of SMMHC/MYH11 in paraffin-embedded human placenta using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of SMMHC/MYH11 in paraffin-embedded mouse kidney using SMMHC/MYH11 Rabbit mAb (A4064) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of paraffin-embedded Rat small intestine using SMMHC/MYH11 Rabbit mAb (A4064, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Human colon using SMMHC/MYH11 Rabbit mAb (A4064, dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
Please remember our product information: SMMHC/MYH11 Rabbit mAb (Catalog Number: A4064) Abclonal
