SATB2 Rabbit mAb (A20220)
$148.00 – $548.00
Abclonal SATB2 Rabbit mAb (Catalog Number: A20220) encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A20220 |
|---|---|
| Product Name | SATB2 Rabbit mAb (A20220) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GLSS; DEL2Q32Q33; C2DELq32q33 |
| Gene Name | SATB2 |
| Protein Name | SATB2 |
| Uniprot/Swissprot ID | Q9UPW6 |
| Entrez GeneID | 23314 |
| Clone | ARC50977 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | WB, IHC-P, IF/ICC, IP |
| Reactivity | Human, Mouse |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A20220: SATB2 Rabbit mAb
This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.
Immunogen Information about SATB2 Rabbit mAb (A20220)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1).
Sequence：HDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR
Gene ID：23314
Swiss prot：Q9UPW6
Synonyms：GLSS; DEL2Q32Q33; C2DELq32q33; SATB2
Calculated MW：83kDa
Observed MW：100kDa
Images of SATB2 Rabbit mAb (A20220)
Western blot analysis of extracts of various cell lines, using SATB2 antibody (A20220) at1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon using SATB2 Rabbit mAb (A20220) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of Mouse brain using SATB2 antibody (A20220) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Please remember our product information: SATB2 Rabbit mAb (Catalog Number: A20220) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |