Progesterone Receptor Rabbit mAb (A19697)
$148.00 – $548.00
Abclonal Progesterone Receptor Rabbit mAb (Catalog Number: A19697) encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy.
- Details & Specifications
- References
- More Offers
| Catalog No. | A19697 |
|---|---|
| Product Name | Progesterone Receptor Rabbit mAb (A19697) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | PR; NR3C3 |
| Gene Name | PGR |
| Protein Name | PGR |
| Uniprot/Swissprot ID | P06401 |
| Gene ID | 5241 |
| Clone | ARC51400 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19697: Progesterone Receptor Rabbit mAb
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap.
Immunogen Information about Progesterone Receptor Rabbit mAb (A19697)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3).
Sequence：AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD
Gene ID：5241
Swiss prot：P06401
Synonyms：PR; NR3C3; Progesterone Receptor
Calculated MW：99kd(CST:90, 118KD)
Observed MW：90kDa
Images of Progesterone Receptor Rabbit mAb (A19697)
Western blot analysis of extracts of BT-474 cells, using Progesterone Receptor antibody (A19697) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human breast using Progesterone Receptor Rabbit mAb (A19697) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using Progesterone Receptor Rabbit mAb (A19697) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: Progesterone Receptor Rabbit mAb (Catalog Number: A19697) Abclonal
