NY-ESO-1 Rabbit mAb (A21229)
$148.00 – $548.00
Abclonal NY-ESO-1 Rabbit mAb (Catalog Number: A21229) encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis.
- Details & Specifications
- References
| Catalog No. | A21229 |
|---|---|
| Product Name | NY-ESO-1 Rabbit mAb (A21229) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1 |
| Gene Name | CTAG1B |
| Protein Name | CTAG1B |
| Uniprot/Swissprot ID | P78358 |
| Gene ID | 1485 |
| Clone | ARC52780 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21229: NY-ESO-1 Rabbit mAb
The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence.
Immunogen Information about NY-ESO-1 Rabbit mAb (A21229)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NY-ESO-1 (P78358).
Sequence:MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM
Gene ID:1485
Swiss prot:P78358
Synonyms:CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1
Calculated MW:18kDa
Observed MW:18kDa
Images of NY-ESO-1 Rabbit mAb (A21229)

Western blot analysis of various lysates using NY-ESO-1 Rabbit mAb (A21229) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of NY-ESO-1 in paraffin-embedded Human testis using NY-ESO-1 Rabbit mAb (A21229) at dilution of 1:2000 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Please remember our product information: NY-ESO-1 Rabbit mAb (Catalog Number: A21229) Abclonal



