NY-ESO-1 Rabbit mAb (A21229)

NY-ESO-1 Rabbit mAb (A21229)

NY-ESO-1 Rabbit mAb (A21229)

$148.00$548.00

In stock

$148.00$548.00

Abclonal NY-ESO-1 Rabbit mAb (Catalog Number: A21229) encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis.

Store
SKU: A21229 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21229
Product NameNY-ESO-1 Rabbit mAb (A21229)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1
Gene Name CTAG1B
Protein Name CTAG1B
Uniprot/Swissprot ID P78358
Gene ID 1485
Clone ARC52780
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21229: NY-ESO-1 Rabbit mAb

The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence.

Immunogen Information about NY-ESO-1 Rabbit mAb (A21229)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NY-ESO-1 (P78358).
Sequence:MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM
Gene ID:1485
Swiss prot:P78358
Synonyms:CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1
Calculated MW:18kDa
Observed MW:18kDa

Images of NY-ESO-1 Rabbit mAb (A21229)

Western blot analysis of various lysates using NY-ESO-1 Rabbit mAb (A21229) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of NY-ESO-1 in paraffin-embedded Human testis using NY-ESO-1 Rabbit mAb (A21229) at dilution of 1:2000 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Please remember our product information: NY-ESO-1 Rabbit mAb (Catalog Number: A21229) Abclonal