NKX2-1 Rabbit mAb (A22247)

NKX2-1 Rabbit mAb (A22247)

NKX2-1 Rabbit mAb (A22247)

$148.00$548.00

In stock

$148.00$548.00

Abclonal NKX2-1 Rabbit mAb (Catalog Number: A22247) encodes a protein initially identified as a thyroid-specific transcription factor.

Store
SKU: A22247 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22247
Product NameNKX2-1 Rabbit mAb (A22247)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1
Gene Name NKX2-1
Protein Name NKX2-1
Uniprot/Swissprot ID P43699
Gene ID 7080
Clone ARC51284
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22247: NKX2-1 Rabbit mAb

This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias ‘TTF1’ with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.

Immunogen Information about NKX2-1 Rabbit mAb (A22247)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human NKX2-1 (NP_003308.1).
Sequence:LEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASG
Gene ID:7080
Swiss prot:P43699
Synonyms:BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1; NKX2-1
Calculated MW:39kDa
Observed MW:42kDa

Images of NKX2-1 Rabbit mAb (A22247)

Western blot analysis of lysates from Mouse lung, using NKX2-1 Rabbit mAb (A22247) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Please remember our product information: NKX2-1 Rabbit mAb (Catalog Number: A22247) Abclonal