NKX2-1 Rabbit mAb (A22247)
$148.00 – $548.00
Abclonal NKX2-1 Rabbit mAb (Catalog Number: A22247) encodes a protein initially identified as a thyroid-specific transcription factor.
- Details & Specifications
- References
| Catalog No. | A22247 |
|---|---|
| Product Name | NKX2-1 Rabbit mAb (A22247) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1 |
| Gene Name | NKX2-1 |
| Protein Name | NKX2-1 |
| Uniprot/Swissprot ID | P43699 |
| Gene ID | 7080 |
| Clone | ARC51284 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22247: NKX2-1 Rabbit mAb
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias ‘TTF1’ with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.
Immunogen Information about NKX2-1 Rabbit mAb (A22247)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human NKX2-1 (NP_003308.1).
Sequence:LEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASG
Gene ID:7080
Swiss prot:P43699
Synonyms:BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1; NKX2-1
Calculated MW:39kDa
Observed MW:42kDa
Images of NKX2-1 Rabbit mAb (A22247)

Western blot analysis of lysates from Mouse lung, using NKX2-1 Rabbit mAb (A22247) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Please remember our product information: NKX2-1 Rabbit mAb (Catalog Number: A22247) Abclonal

