MUC1 Rabbit mAb (A19081)
$148.00 – $548.00
Abclonal MUC1 Rabbit mAb (Catalog Number: A19081) encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces.
- Details & Specifications
- References
| Catalog No. | A19081 |
|---|---|
| Product Name | MUC1 Rabbit mAb (A19081) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | EMA; MCD; PEM; PUM; KL-6; MAM6; MCKD; PEMT; CD227; H23AG; MCKD1; MUC-1; ADMCKD; ADTKD2; Ca15-3; ADMCKD1; CA 15-3; MUC-1/X; MUC1/ZD; MUC-1/SEC |
| Gene Name | MUC1 |
| Protein Name | MUC1 |
| Uniprot/Swissprot ID | P15941 |
| Gene ID | 4582 |
| Clone | ARC0352 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19081: MUC1 Rabbit mAb
This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.
Immunogen Information about MUC1 Rabbit mAb (A19081)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human MUC1 (P15941).
Sequence:VPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Gene ID:4582
Swiss prot:P15941
Synonyms:EMA; MCD; PEM; PUM; KL-6; MAM6; MCKD; PEMT; CD227; H23AG; MCKD1; MUC-1; ADMCKD; ADTKD2; Ca15-3; ADMCKD1; CA 15-3; MUC-1/X; MUC1/ZD; MUC-1/SEC; MUC1
Calculated MW:122kDa
Observed MW:25kDa/200kDa
Images of MUC1 Rabbit mAb (A19081)

Western blot analysis of lysates from Rat lung, using MUC1 Rabbit mAb (A19081) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Western blot analysis of lysates from Rat lung, using MUC1 Rabbit mAb (A19081) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1min.

Immunohistochemistry analysis of MUC1 in paraffin-embedded human breast cancer using MUC1 Rabbit mAb (A19081) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of MUC1 in paraffin-embedded Human cervical squamous cell carcinoma using MUC1 Rabbit mAb (A19081) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of MUC1 in paraffin-embedded human colon using MUC1 Rabbit mAb (A19081) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of MUC1 in paraffin-embedded human kidney using MUC1 Rabbit mAb (A19081) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of MUC1 in paraffin-embedded human lung cancer using MUC1 Rabbit mAb (A19081) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of MUC1 in paraffin-embedded human tonsil using MUC1 Rabbit mAb (A19081) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: MUC1 Rabbit mAb (Catalog Number: A19081) Abclonal







