[KO Validated] MSH2 Rabbit mAb (A22177)
$148.00 – $548.00
Abclonal [KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177) This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22177 |
---|---|
Product Name | [KO Validated] MSH2 Rabbit mAb (A22177) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | FCC1; COCA1; HNPCC; LCFS2; MSH-2; hMSH2; HNPCC1; LYNCH1; MMRCS2 |
Gene Name | MSH2 |
Protein Name | MSH2 |
Uniprot/Swissprot ID | P43246 |
Entrez GeneID | 4436 |
Clone | ARC55799 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | WB, IHC-P |
Reactivity | Human, Mouse, Rat |
Conjugate | Unconjugated |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22177: [KO Validated] MSH2 Rabbit mAb
This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about [KO Validated] MSH2 Rabbit mAb (A22177)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 330-583 of human MSH2 (NP_000242.1).
Sequence:LNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVN
Gene ID:4436
Swiss prot:P43246
Synonyms:FCC1; COCA1; HNPCC; LCFS2; MSH-2; hMSH2; HNPCC1; LYNCH1; MMRCS2; H2
Calculated MW:105kDa
Observed MW:105kDa
Images of [KO Validated] MSH2 Rabbit mAb (A22177)
Western blot analysis of extracts from wild type(WT) and MSH2 knockout (KO) HeLa cells, using MSH2 antibody (A22177) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates, using MSH2 antibody (A22177) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] MSH2 Rabbit mAb (A22177) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using [KO Validated] MSH2 Rabbit mAb (A22177) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: [KO Validated] MSH2 Rabbit mAb (Catalog Number: A22177) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 20 ul, 100 ul, 200 ul, 50 ul |