[KO Validated] MLH1 Rabbit mAb (A4858)

Catalog No.	A4858
Product Name	[KO Validated] MLH1 Rabbit mAb (A4858)
Supplier Name	ABclonal, Inc.
Brand Name	Abclonal
Synonyms	FCC2; COCA2; HNPCC; MLH-1; hMLH1; HNPCC2; LYNCH2; MMRCS1
Gene Name	MLH1
Protein Name	MLH1
Uniprot/Swissprot ID	P40692
Entrez GeneID	4292
Clone	ARC53543
Clonality	Monoclonal
Source/Host	Rabbit
Applications	WB, IHC-P
Reactivity	Human, Mouse
Conjugate	Unconjugated
Note	Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline	Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A4858: [KO Validated] MLH1 Rabbit mAb

The protein encoded by this gene can heterodimerize with mismatch repair endonuclease PMS2 to form MutL alpha, part of the DNA mismatch repair system. When MutL alpha is bound by MutS beta and some accessory proteins, the PMS2 subunit of MutL alpha introduces a single-strand break near DNA mismatches, providing an entry point for exonuclease degradation. The encoded protein is also involved in DNA damage signaling and can heterodimerize with DNA mismatch repair protein MLH3 to form MutL gamma, which is involved in meiosis. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC).

Immunogen Information about [KO Validated] MLH1 Rabbit mAb (A4858)

Immunogen：A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MLH1 (NP_000240.1).
Sequence：PGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGD
Gene ID：4292
Swiss prot：P40692
Synonyms：FCC2; COCA2; HNPCC; MLH-1; hMLH1; HNPCC2; LYNCH2; MMRCS1; H1
Calculated MW：85kDa
Observed MW：85kDa

Images of [KO Validated] MLH1 Rabbit mAb (A4858)

Western blot analysis of extracts of mouse brain, using MLH1 antibody (A4858) at1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of extracts from normal (control) and MLH1 knockout (KO) HeLa cells, using MLH1 antibody (A4858) at1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] MLH1 Rabbit mAb (A4858) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: [KO Validated] MLH1 Rabbit mAb (Catalog Number: A4858) Abclonal

Additional information

Ship from Country	USA
Size	20 ul, 100 ul, 200 ul, 50 ul

No more offers for this product!