CEACAM5 Mouse mAb (A18131)
$148.00 – $548.00
Abclonal CEACAM5 Mouse mAb (Catalog Number: A18131) encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A18131 |
|---|---|
| Product Name | CEACAM5 Mouse mAb (A18131) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CEA; CD66e |
| Gene Name | CEACAM5 |
| Protein Name | CEACAM5 |
| Uniprot/Swissprot ID | P06731 |
| Entrez GeneID | 1048 |
| Clone | AMC0141 |
| Clonality | Monoclonal |
| Source/Host | Mouse |
| Applications | WB, IHC-P, IP |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A18131: CEACAM5 Mouse mAb
This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants.
Immunogen Information about CEACAM5 Mouse mAb (A18131)
Immunogen： Recombinant fusion protein containing a sequence corresponding to amino acids 35-685 of human CEACAM5.
Sequence： KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Gene ID： 1048
Swiss prot： P06731
Synonyms： CEA; CD66e; CEACAM5
Calculated MW： 77kDa
Observed MW： 200kDa
Images of CEACAM5 Mouse mAb (A18131)
Western blot analysis of lysates from MCF7 cells, using CEACAM5 Mouse mAb (A18131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of CEACAM5 in paraffin-embedded human appendix using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CEACAM5 in paraffin-embedded human gastric cancer using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CEACAM5 in paraffin-embedded Human hepatocellular carcinoma using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CEACAM5 in paraffin-embedded human urothelial carcinoma using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: CEACAM5 Mouse mAb (Catalog Number: A18131) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |