CD68 Rabbit mAb (A23205)
$148.00 – $548.00
Abclonal CD68 Rabbit mAb (Catalog Number: A23205) encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family.
- Details & Specifications
- References
- More Offers
| Catalog No. | A23205 |
|---|---|
| Product Name | CD68 Rabbit mAb (A23205) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GP110; LAMP4; SCARD1 |
| Gene Name | CD68 |
| Protein Name | CD68 |
| Uniprot/Swissprot ID | P34810 |
| Gene ID | 968 |
| Clone | ARC51152 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23205: CD68 Rabbit mAb
This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.
Immunogen Information about CD68 Rabbit mAb (A23205)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).
Sequence：TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
Gene ID：968
Swiss prot：P34810
Synonyms：GP110; LAMP4; SCARD1; CD68
Calculated MW：37kDa
Observed MW：80-130kDa
Images of CD68 Rabbit mAb (A23205)
Western blot analysis of various lysates, using CD68 Rabbit mAb (A23205) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of CD68 in paraffin-embedded human colon using CD68 Rabbit mAb (A23205) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CD68 in paraffin-embedded human liver using CD68 Rabbit mAb (A23205) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CD68 in paraffin-embedded human lung using CD68 Rabbit mAb (A23205) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of CD68 in paraffin-embedded human tonsil using CD68 Rabbit mAb (A23205) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of paraffin-embedded Human tonsil tissue using CD68 Rabbit mAb (A23205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Please remember our product information: CD68 Rabbit mAb (Catalog Number: A23205) Abclonal
