CD44 Rabbit mAb (A21919)
$148.00 – $548.00
Abclonal CD44 Rabbit mAb (Catalog Number: A21919) encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration.
- Details & Specifications
- References
| Catalog No. | A21919 |
|---|---|
| Product Name | CD44 Rabbit mAb (A21919) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1 |
| Gene Name | CD44 |
| Protein Name | CD44 |
| Uniprot/Swissprot ID | P16070 |
| Gene ID | 960 |
| Clone | ARC0464 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21919: CD44 Rabbit mAb
The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.
Immunogen Information about CD44 Rabbit mAb (A21919)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD44 (P16070).
Sequence:NNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFST
Gene ID:960
Swiss prot:P16070
Synonyms:IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1; CD44
Calculated MW:82kDa
Observed MW:80kDa
Images of CD44 Rabbit mAb (A21919)

Western blot analysis of extracts of U-251MG cells, using CD44 antibody (A21919) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded human liver using CD44 Rabbit mAb (A21919) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human skin using CD44 Rabbit mAb (A21919) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: CD44 Rabbit mAb (Catalog Number: A21919) Abclonal





