CD34 Rabbit mAb (A19015)
$148.00 – $548.00
Abclonal CD34 Rabbit mAb (Catalog Number: A19015) encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A19015 |
---|---|
Product Name | CD34 Rabbit mAb (A19015) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | CD34;CD34 molecule;GIG3;MORT1 |
Gene Name | CD34 |
Protein Name | CD34 |
Uniprot/Swissprot ID | P28906 |
Entrez GeneID | 947 |
Clone | ARC0219 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | WB, IHC-P |
Reactivity | Human, Mouse, Rat |
Conjugate | Unconjugated |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19015: CD34 Rabbit mAb
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about CD34 Rabbit mAb (A19015)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906).
Sequence:YSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Gene ID:947
Swiss prot:P28906
Synonyms:CD34; CD34 molecule; GIG3; MORT1
Calculated MW:41kDa
Observed MW:120kDa
Images of CD34 Rabbit mAb (A19015)
Western blot analysis of extracts of various cell lines, using CD34 antibody (A19015) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human kidney using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human kidney using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human kidney using CD34 Rabbit mAb (A19015) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: CD34 Rabbit mAb (Catalog Number: A19015) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 20 ul, 100 ul, 200 ul, 50 ul |