CD30 Rabbit mAb (A21230)

CD30 Rabbit mAb (A21230)

CD30 Rabbit mAb (A21230)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD30 Rabbit mAb (Catalog Number: A21230) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells.

Store
SKU: A21230 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21230
Product NameCD30 Rabbit mAb (A21230)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD30; Ki-1; D1S166E
Gene Name TNFRSF8
Protein Name TNFRSF8
Uniprot/Swissprot ID P28908
Gene ID 943
Clone ARC52949
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21230: CD30 Rabbit mAb

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen Information about CD30 Rabbit mAb (A21230)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence:FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID:943
Swiss prot:P28908
Synonyms:CD30; Ki-1; D1S166E
Calculated MW:14kDa/50kDa/63kDa
Observed MW:Refer to figures

Images of CD30 Rabbit mAb (A21230)

Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of K-562 cells using CD30 Rabbit mAb (A21230, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Flow cytometry: 1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with CD30 Rabbit mAb (A21230, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor®647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: CD30 Rabbit mAb (Catalog Number: A21230) Abclonal