CD30 Rabbit mAb (A21230)
$148.00 – $548.00
Abclonal CD30 Rabbit mAb (Catalog Number: A21230) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells.
- Details & Specifications
- References
- More Offers
| Catalog No. | A21230 |
|---|---|
| Product Name | CD30 Rabbit mAb (A21230) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD30; Ki-1; D1S166E |
| Gene Name | TNFRSF8 |
| Protein Name | TNFRSF8 |
| Uniprot/Swissprot ID | P28908 |
| Gene ID | 943 |
| Clone | ARC52949 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21230: CD30 Rabbit mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Immunogen Information about CD30 Rabbit mAb (A21230)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence:FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID:943
Swiss prot:P28908
Synonyms:CD30; Ki-1; D1S166E
Calculated MW:14kDa/50kDa/63kDa
Observed MW:Refer to figures
Images of CD30 Rabbit mAb (A21230)

Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of K-562 cells using CD30 Rabbit mAb (A21230, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Flow cytometry: 1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with CD30 Rabbit mAb (A21230, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor®647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: CD30 Rabbit mAb (Catalog Number: A21230) Abclonal







