CD30 Rabbit mAb (A21230)
$148.00 – $548.00
Abclonal CD30 Rabbit mAb (Catalog Number: A21230) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells.
- Details & Specifications
- References
- More Offers
| Catalog No. | A21230 |
|---|---|
| Product Name | CD30 Rabbit mAb (A21230) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD30; Ki-1; D1S166E |
| Gene Name | TNFRSF8 |
| Protein Name | TNFRSF8 |
| Uniprot/Swissprot ID | P28908 |
| Gene ID | 943 |
| Clone | ARC52949 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21230: CD30 Rabbit mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Immunogen Information about CD30 Rabbit mAb (A21230)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence：FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID：943
Swiss prot：P28908
Synonyms：CD30; Ki-1; D1S166E
Calculated MW：14kDa/50kDa/63kDa
Observed MW：Refer to figures
Images of CD30 Rabbit mAb (A21230)
Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of K-562 cells using CD30 Rabbit mAb (A21230, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.
Flow cytometry: 1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with CD30 Rabbit mAb (A21230, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor®647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: CD30 Rabbit mAb (Catalog Number: A21230) Abclonal
