CD20 Rabbit mAb (A4893)
$148.00 – $548.00
Abclonal CD20 Rabbit mAb (Catalog Number: A4893) encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
- Details & Specifications
- References
| Catalog No. | A4893 |
|---|---|
| Product Name | CD20 Rabbit mAb (A4893) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 |
| Gene Name | MS4A1 |
| Protein Name | MS4A1 |
| Uniprot/Swissprot ID | P11836 |
| Gene ID | 931 |
| Clone | ARC51683 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A4893: CD20 Rabbit mAb
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Immunogen Information about CD20 Rabbit mAb (A4893)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).
Sequence:LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID:931
Swiss prot:P11836
Synonyms:B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Calculated MW:33kDa
Observed MW:30-50kDa
Images of CD20 Rabbit mAb (A4893)

Western blot analysis of extracts of various cell lines, using CD20 Rabbit mAb (A4893) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Western blot analysis of various lysates, using CD20 Rabbit mAb (A4893) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HeLa
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma using CD20 Rabbit mAb (A4893) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD20 Rabbit mAb (A4893) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD20 Rabbit mAb (A4893) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of Daudi and Jurkat(Negative control) cells using CD20 Rabbit mAb (A4893, dilution 1:1000)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with CD20 Rabbit mAb (A4893, 10 μg/mL orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 10 μg/mL, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: CD20 Rabbit mAb (Catalog Number: A4893) Abclonal







