Caveolin-1 Rabbit mAb (A19006)

Caveolin-1 Rabbit mAb (A19006)

Caveolin-1 Rabbit mAb (A19006)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Caveolin-1 Rabbit mAb (Catalog Number: A19006) encoded by this gene is the main component of the caveolae plasma membranes found in most cell types.

Store
SKU: A19006 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19006
Product NameCaveolin-1 Rabbit mAb (A19006)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085
Gene Name CAV1
Protein Name CAV1
Uniprot/Swissprot ID Q03135
Gene ID 857
Clone ARC50848
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19006: Caveolin-1 Rabbit mAb

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.

Immunogen Information about Caveolin-1 Rabbit mAb (A19006)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2).
Sequence:MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS
Gene ID:857
Swiss prot:Q03135
Synonyms:CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085; Caveolin-1
Calculated MW:17kDa/20kDa
Observed MW:21kDa/24kDa

Images of Caveolin-1 Rabbit mAb (A19006)

Western blot analysis of various lysates, using Caveolin-1 antibody (A19006) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of HeLa, using Caveolin-1 antibody (A19006) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human colon using Caveolin-1 antibody (A19006) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung using Caveolin-1 antibody (A19006) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: Caveolin-1 Rabbit mAb (Catalog Number: A19006) Abclonal