Caveolin-1 Rabbit mAb (A19006)
$148.00 – $548.00
Abclonal Caveolin-1 Rabbit mAb (Catalog Number: A19006) encoded by this gene is the main component of the caveolae plasma membranes found in most cell types.
- Details & Specifications
- References
| Catalog No. | A19006 |
|---|---|
| Product Name | Caveolin-1 Rabbit mAb (A19006) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085 |
| Gene Name | CAV1 |
| Protein Name | CAV1 |
| Uniprot/Swissprot ID | Q03135 |
| Gene ID | 857 |
| Clone | ARC50848 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19006: Caveolin-1 Rabbit mAb
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
Immunogen Information about Caveolin-1 Rabbit mAb (A19006)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2).
Sequence:MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS
Gene ID:857
Swiss prot:Q03135
Synonyms:CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085; Caveolin-1
Calculated MW:17kDa/20kDa
Observed MW:21kDa/24kDa
Images of Caveolin-1 Rabbit mAb (A19006)

Western blot analysis of various lysates, using Caveolin-1 antibody (A19006) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of HeLa, using Caveolin-1 antibody (A19006) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human colon using Caveolin-1 antibody (A19006) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung using Caveolin-1 antibody (A19006) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: Caveolin-1 Rabbit mAb (Catalog Number: A19006) Abclonal






