AMACR/p504S Rabbit mAb (A22407)
$148.00 – $548.00
Abclonal AMACR/p504S Rabbit mAb (Catalog Number: A22407) encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers.
- Details & Specifications
- References
| Catalog No. | A22407 |
|---|---|
| Product Name | AMACR/p504S Rabbit mAb (A22407) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | RM; RACE; CBAS4; P504S; AMACRD |
| Gene Name | AMACR |
| Protein Name | AMACR |
| Uniprot/Swissprot ID | Q9UHK6 |
| Gene ID | 23600 |
| Clone | ARC50876 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22407: AMACR/p504S Rabbit mAb
This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Immunogen Information about AMACR/p504S Rabbit mAb (A22407)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4).
Sequence:MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGR
Gene ID:23600
Swiss prot:Q9UHK6
Synonyms:RM; RACE; CBAS4; P504S; AMACRD; AMACR/p504S
Calculated MW:42kDa
Observed MW:42kDa
Images of AMACR/p504S Rabbit mAb (A22407)

Western blot analysis of various lysates, using AMACR Rabbit mAb (A22407) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates, using AMACR Rabbit mAb (A22407) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human kidney using AMACR Rabbit mAb (A22407) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: AMACR/p504S Rabbit mAb (Catalog Number: A22407) Abclonal





