ABflo® 647 Rabbit anti-Human CD97 mAb (A22501)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD97 mAb (Catalog Number: A22501) encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22501 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD97 mAb (A22501) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD97; TM7LN1 |
| Gene Name | ADGRE5 |
| Protein Name | ADGRE5 |
| Uniprot/Swissprot ID | P48960 |
| Gene ID | 976 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22501: ABflo® 647 Rabbit anti-Human CD97 mAb
This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD97 mAb (A22501)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 21-398 of human CD97 (NP_510966.1).
Sequence:QDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAV
Gene ID:976
Swiss prot:P48960
Synonyms:CD97; TM7LN1
Calculated MW:92kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD97 mAb (A22501)

Flow cytometry: 1X10^6 MOLT-4 cells (Low Expression, left) and U-937 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 U-937 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).

Flow cytometry: 1X10^6 MOLT-4 cells (Low Expression) were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD97 mAb (Catalog Number: A22501) Abclonal






