ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD70 mAb (Catalog Number: A22303) encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22303 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human CD70 mAb (A22303) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A |
Gene Name | CD70 |
Protein Name | CD70 |
Uniprot/Swissprot ID | P32970 |
Entrez GeneID | 970 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22303: ABflo® 647 Rabbit anti-Human CD70 mAb
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 39-193 of human CD70 (P32970).
Sequence:QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Gene ID:970
Swiss prot:P32970
Synonyms:CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
Calculated MW:21kDa/23kDa
Observed MW:Refer to figures
Images of ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)
Flow cytometry: 1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD70 mAb (A22303, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD70 mAb (A22303, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD70 mAb (Catalog Number: A22303) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |