ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb (A22583)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb (Catalog Number: A22583) encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22583 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb (A22583) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD215 |
| Gene Name | IL15RA |
| Protein Name | IL15RA |
| Uniprot/Swissprot ID | Q13261 |
| Entrez GeneID | 3601 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22583: ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb
This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb (A22583)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 31-205 of human CD215/IL-15R alpha (NP_002180.1).
Sequence：ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Gene ID：3601
Swiss prot：Q13261
Synonyms：CD215
Calculated MW：28kDa
Observed MW：
Images of ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb (A22583)
Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb(A22583, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb(A22583, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb(A22583, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb(A22583, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD215/IL-15R alpha mAb (Catalog Number: A22583) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |