ABflo® 647 Rabbit anti-Human CD150/SLAM mAb (A22581)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD150/SLAM mAb (Catalog Number: A22581) Enables SH2 domain binding activity and identical protein binding activity. Involved in several processes, including negative regulation of CD40 signaling pathway; negative regulation of cytokine production; and positive regulation of MAPK cascade.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22581 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human CD150/SLAM mAb (A22581) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | SLAM; CD150; CDw150 |
Gene Name | SLAMF1 |
Protein Name | SLAMF1 |
Uniprot/Swissprot ID | Q13291 |
Entrez GeneID | 6504 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22581: ABflo® 647 Rabbit anti-Human CD150/SLAM mAb
Enables SH2 domain binding activity and identical protein binding activity. Involved in several processes, including negative regulation of CD40 signaling pathway; negative regulation of cytokine production; and positive regulation of MAPK cascade. Located in extracellular exosome.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD150/SLAM mAb (A22581)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 21-237 of human CD150 (NP_003028.1).
Sequence:ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
Gene ID:6504
Swiss prot:Q13291
Synonyms:SLAM; CD150; CDw150
Calculated MW:37kDa
Observed MW:Refer to figures
Images of ABflo® 647 Rabbit anti-Human CD150/SLAM mAb (A22581)
Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human CD150/SLAM mAb(A22581, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti- Human CD150/SLAM mAb(A22581, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD150/SLAM mAb(A22581, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD150/SLAM mAb(A22581, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD150/SLAM mAb (Catalog Number: A22581) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |