ABflo® 647 Rabbit anti-Dog CD27 mAb (A22576)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Dog CD27 mAb (Catalog Number: A22576) encoded by this gene is a member of the TNF-receptor superfamily.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22576 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Dog CD27 mAb (A22576) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | T14; S152; Tp55; TNFRSF7; S152. LPFS2 |
Gene Name | CD27 |
Protein Name | CD27 |
Entrez GeneID | 611674 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Dog |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22576: ABflo® 647 Rabbit anti-Dog CD27 mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
Immunogen Information about ABflo® 647 Rabbit anti-Dog CD27 mAb (A22576)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-215 of dog ABflo® 647 Rabbit anti-Dog CD27 (XP_038295140.1).
Sequence:ATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAAQCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTECDPPSNPLLIPHPSPARGPHLQPTHLPYAKIKFQATLCPVTGIVRLSPQSPPSPKMQETSTVRQVQTLADFRWLPAPALSTHWPPQRSLCSSDCIR
Gene ID:611674
Swiss prot:
Synonyms:T14; S152; Tp55; TNFRSF7; S152. LPFS2
Calculated MW:31kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Dog CD27 mAb (A22576)
Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD27 mAb(A22576, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti- Dog CD27 mAb(A22576, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Dog CD27 mAb (Catalog Number: A22576) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |