ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22786)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (Catalog Number: A22786) Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium.
- Details & Specifications
- References
- More Offers
Catalog No. | A22786 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22786) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1 |
Gene Name | Ly6a |
Protein Name | Ly6a |
Uniprot/Swissprot ID | P08648 |
Gene ID | 110454 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Mouse |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22786: ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb
Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).
Immunogen Information about ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22786)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-111 of mouse Ly-6A/E (Sca-1)(NP_034868.1)
Sequence:LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
Gene ID:110454
Swiss prot:P05533
Synonyms:TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1
Calculated MW:14kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22786)
Flow cytometry:1X10^6 RAW 264.7cells (negative control, Left) and C57BL/6 mouse splenocytes (Right) were surface-stained with ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) fragment mAb(A22786, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse Ly-6A/E(Sca-1) mAb(A22786, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (Catalog Number: A22786) Abclonal