ABflo® 488 Rabbit anti-Human ULBP2 mAb (A22694)

ABflo® 488 Rabbit anti-Human ULBP2 mAb (A22694)

ABflo® 488 Rabbit anti-Human ULBP2 mAb (A22694)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Human ULBP2 mAb (Catalog Number: A22694) encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells.

Store
SKU: A22694 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22694
Product NameABflo® 488 Rabbit anti-Human ULBP2 mAb (A22694)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha
Gene Name ULBP2
Protein Name ULBP2
Uniprot/Swissprot ID Q9BZM5
Gene ID 80328
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22694: ABflo® 488 Rabbit anti-Human ULBP2 mAb

This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6.

Immunogen Information about ABflo® 488 Rabbit anti-Human ULBP2 mAb (A22694)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 26-217 of human ULBP2 (NP_079493.1).
Sequence:GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
Gene ID:80328
Swiss prot:Q9BZM5
Synonyms:N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha
Calculated MW:27kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human ULBP2 mAb (A22694)

Flow cytometry:1X10^6 SH-SY5Y cells (negative control, Left) and HeLa cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human ULBP2 mAb(A22694, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HeLa cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human ULBP2 mAb(A22694, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human ULBP2 mAb (Catalog Number: A22694) Abclonal