ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A22156)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (Catalog Number: A22156) encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22156 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A22156) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | B7H3; B7-H3; B7RP-2; 4Ig-B7-H3 |
| Gene Name | CD276 |
| Protein Name | CD276 |
| Uniprot/Swissprot ID | Q5ZPR3 |
| Entrez GeneID | 80381 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22156: ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb
The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3′ UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A22156)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 29-245 of human CD276/B7-H3 (NP_079516.1).
Sequence：LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Gene ID：80381
Swiss prot：Q5ZPR3
Synonyms：B7H3; B7-H3; B7RP-2; 4Ig-B7-H3
Calculated MW：33kDa/52kDa/57kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A22156)
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and PC-3 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb(A22156, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 C2C12 cells were surface-stained with ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb(A22156, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained C2C12 cells was used as blank control (red line).
Flow cytometry:1X10^6 C2C12 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb(A22156, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (Catalog Number: A22156) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |