ABflo® 488 Rabbit anti-Human Galectin 3 mAb (A23016)
$140.00 – $388.00
Abclonal ABflo® 488 Rabbit anti-Human Galectin 3 mAb (Catalog Number: A23016) encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides.
- Details & Specifications
- References
- More Offers
Catalog No. | A23016 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Human Galectin 3 mAb (A23016) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2 |
Gene Name | LGALS3 |
Protein Name | LGALS3 |
Uniprot/Swissprot ID | P17931 |
Gene ID | 3958 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23016: ABflo® 488 Rabbit anti-Human Galectin 3 mAb
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
Immunogen Information about ABflo® 488 Rabbit anti-Human Galectin 3 mAb (A23016)
Immunogen:Recombinant protein of human Galectin 3.
Sequence:MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Gene ID:3958
Swiss prot:P17931
Synonyms:L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Calculated MW:26kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human Galectin 3 mAb (A23016)
Flow cytometry:1X10^6 Jurkat cells(Low Expression control, Left) and MCF7 cells (Right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human Galectin 3 mAb(A23016, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 MCF7 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human Galectin 3 mAb(A23016, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 488 Rabbit anti-Human Galectin 3 mAb(A23016, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human Galectin 3 mAb(A23016, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human Galectin 3 mAb (Catalog Number: A23016) Abclonal