ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23173)

ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23173)

ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23173)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (Catalog Number: A23173) encodes a C-type lectin that functions in cell adhesion and pathogen recognition.

Store
SKU: A23173 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23173
Product NameABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23173)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
Gene Name CLEC4M
Protein Name CLEC4M
Uniprot/Swissprot ID Q9H2X3
Gene ID 10332
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23173: ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb

This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses including Ebola, hepatitis C, HIV-1, influenza A, West Nile virus and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain of variable length, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CD209 (Gene ID: 30835), also known as DC-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression in endothelial cells of the liver, lymph node and placenta. Polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection.

Immunogen Information about ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23173)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 71-399 of human DC-SIGNR/CD299 (NP_055072.3).
Sequence:QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Gene ID:10332
Swiss prot:Q9H2X3
Synonyms:CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
Calculated MW:24kDa-45kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (A23173)

Flow cytometry:1X10^6 293T cells (negative control, Left) and 293T(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb(A23173, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb(A23173, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human DC-SIGNR/CD299 mAb (Catalog Number: A23173) Abclonal