ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human CD51 mAb (Catalog Number: A22298) belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22298 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Human CD51 mAb (A22298) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | CD51; MSK8; VNRA; VTNR |
Gene Name | ITGAV |
Protein Name | ITGAV |
Uniprot/Swissprot ID | P06756 |
Entrez GeneID | 3685 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC(Intra) |
Reactivity | Human |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22298: ABflo® 488 Rabbit anti-Human CD51 mAb
The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2).
Sequence:SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Gene ID:3685
Swiss prot:P06756
Synonyms:CD51; MSK8; VNRA; VTNR
Calculated MW:116kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human CD51 mAb (A22298)
Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and BeWo cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD51 mAb(A22298, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 BeWo cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD51 mAb(A22298, 5 μl/Test, right).
Flow cytometry:1X10^6 MOLT-4 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD51 mAb(A22298, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD51 mAb (Catalog Number: A22298) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |