ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (Catalog Number: A22310) Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22310 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | 9-27; CD225; IFI17; LEU13; DSPA2a |
| Gene Name | IFITM1 |
| Protein Name | IFITM1 |
| Uniprot/Swissprot ID | P13164 |
| Entrez GeneID | 8519 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | IF/ICC, FC(Intra) |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22310: ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb
Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310)
Immunogen：Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4).
Sequence：MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS
Gene ID：8519
Swiss prot：P13164
Synonyms：9-27; CD225; IFI17; LEU13; DSPA2a
Calculated MW：14kDa
Observed MW：
Images of ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310)
Immunofluorescence analysis of K-562 cells using ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Flow cytometry: 1X10^6 U-251MG cells (Low Expression, left) and K-562 cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 K-562 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310, 5 μl/Test, right).
Flow cytometry: 1X10^6 U-251MG cells (Low Expression) were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (Catalog Number: A22310) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |